PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g088840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 655aa    MW: 73058.7 Da    PI: 10.4482
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g088840.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.42.1e-2179174299
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     f +l+++ +l ++ l+lp + +++ g++  +s +++++de+ rsW + l+++k+s+++++t+GW++F+++ng k+g ++vFkl+g +++++v+++
  Csa09g088840.1  79 FVALVTAWNLHKDTLSLPQDLTSSVGLQRSCS-EIVVTDERERSWPLDLRFNKSSETFYITRGWRSFCNENGKKAGGVFVFKLVG-NRETPVLSF 171
                     5678999999*****************98887.***************************************************9.666699999 PP

                     E-S CS
              B3  97 frk 99 
                     +++
  Csa09g088840.1 172 CST 174
                     986 PP

2B359.94.4e-19215308299
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     +  ++++++lk+gr +lp +f++++ ++k++  ++tl  + g +W+  l+ r   g++vl+kGW++Fv+angL +g +++++ ++ +++++++++
  Csa09g088840.1 215 VALTLTHNSLKKGRQYLPSSFVRKNVLDKHG--MITLLGKAGMKWRASLK-REANGSMVLGKGWRDFVNANGLTSGKSFTLEAIS-EKGTPMLSL 305
                     566778999****************999766..8***************4.5555569************************998.8999***99 PP

                     E-S CS
              B3  97 frk 99 
                     +++
  Csa09g088840.1 306 CST 308
                     986 PP

3B335.12.4e-11362431375
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT-- CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLk 75 
                     + + ++ +l +gr +lp +fa ++g++k++   +tl  e+g +We +l  r+k+g++ l+kGW++F +an ++
  Csa09g088840.1 362 TLTQTHANLIKGRQYLPLSFAIANGLDKPG--IITLVGEDGAKWEANL-LRGKRGTMCLGKGWRHFTRANSIN 431
                     55556677778999*************776..8***************.7888899**************875 PP

4B352.96.7e-17479573199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++d+l +gr +lp +f++e+g++k++  ++ l  ++g +We ++  r+k g++ ++kGWk+F+ angLk+g++++++ +  ++++++++
  Csa09g088840.1 479 FVTLTLRHDNLITGRRYLPFSFTRENGLDKPG--KINLIGKDGTKWEANI-GRGKTGMMCIGKGWKDFAIANGLKSGESFTLEAIL-ENGTPMLS 569
                     667778899999*****************777..7***************.68888889************************776.88889999 PP

                     EE-S CS
              B3  96 vfrk 99 
                     +f++
  Csa09g088840.1 570 LFST 573
                     9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.8E-2171174IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.04E-2074174IPR015300DNA-binding pseudobarrel domain
CDDcd100171.46E-1578173No hitNo description
PROSITE profilePS5086314.45278174IPR003340B3 DNA binding domain
PfamPF023629.8E-2079174IPR003340B3 DNA binding domain
SMARTSM010193.0E-2979175IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-20205315IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.59E-20209309IPR015300DNA-binding pseudobarrel domain
CDDcd100177.31E-16213307No hitNo description
PROSITE profilePS5086314.917214309IPR003340B3 DNA binding domain
PfamPF023621.4E-18214308IPR003340B3 DNA binding domain
SMARTSM010193.7E-28214309IPR003340B3 DNA binding domain
SuperFamilySSF1019361.69E-13358431IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.897360454IPR003340B3 DNA binding domain
PfamPF023623.9E-10360431IPR003340B3 DNA binding domain
SMARTSM010192.0E-9360455IPR003340B3 DNA binding domain
CDDcd100171.04E-11360430No hitNo description
Gene3DG3DSA:2.40.330.109.8E-12360431IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-14469568IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-16476566IPR015300DNA-binding pseudobarrel domain
CDDcd100172.79E-16478572No hitNo description
PROSITE profilePS5086314.311479574IPR003340B3 DNA binding domain
PfamPF023628.6E-16479573IPR003340B3 DNA binding domain
SMARTSM010193.6E-27479574IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.3E-6611649IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MVLNLSDFGL CYYENQDLPA PSSNNDQDKT GNISRKKLRR MRTDEGDDYQ DNTEHVRKKK  60
MKNNLDTEVD SSSSDHSCFV ALVTAWNLHK DTLSLPQDLT SSVGLQRSCS EIVVTDERER  120
SWPLDLRFNK SSETFYITRG WRSFCNENGK KAGGVFVFKL VGNRETPVLS FCSTESVNDG  180
TQGDKNNKEN CVQLERKQKR MRFRVSTLSS QNRFVALTLT HNSLKKGRQY LPSSFVRKNV  240
LDKHGMITLL GKAGMKWRAS LKREANGSMV LGKGWRDFVN ANGLTSGKSF TLEAISEKGT  300
PMLSLCSTQS TSDRSQQREC SKAFEKESIS TKPSSGNKMR KAKDKRERRR DSLPASMNRF  360
VTLTQTHANL IKGRQYLPLS FAIANGLDKP GIITLVGEDG AKWEANLLRG KRGTMCLGKG  420
WRHFTRANSI NPQVIETSNS KDSEKESILA GHSSGKETRK AKDKIEGRRD SLPASMNRFV  480
TLTLRHDNLI TGRRYLPFSF TRENGLDKPG KINLIGKDGT KWEANIGRGK TGMMCIGKGW  540
KDFAIANGLK SGESFTLEAI LENGTPMLSL FSTEATSGRS QQGELCKDSE KGSIAAEPTS  600
RNKATSNREE RRDSSSTINN RFVRLTLAPE DVRDCKLIIP SQFMKANGIN KLGG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13461RKKLRRMRTDEGDDYQDNTEHVRKKKMK
2338345MRKAKDKR
3339346RKAKDKRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417224.10.0PREDICTED: B3 domain-containing protein REM12-like
SwissprotP0CAP41e-165REM12_ARATH; B3 domain-containing protein REM12
TrEMBLD7LIB40.0D7LIB4_ARALL; Predicted protein
STRINGAl_scaffold_0004_4880.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.11e-155B3 family protein